Lineage for d1f3ja1 (1f3j A:83-181)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107077Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1107127Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1107158Domain d1f3ja1: 1f3j A:83-181 [21645]
    Other proteins in same PDB: d1f3ja2, d1f3jb1, d1f3jb2, d1f3jd2, d1f3je1, d1f3je2
    complexed with nag

Details for d1f3ja1

PDB Entry: 1f3j (more details), 3.1 Å

PDB Description: histocompatibility antigen i-ag7
PDB Compounds: (A:) h-2 class II histocompatibility antigen

SCOPe Domain Sequences for d1f3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3ja1 b.1.1.2 (A:83-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepe

SCOPe Domain Coordinates for d1f3ja1:

Click to download the PDB-style file with coordinates for d1f3ja1.
(The format of our PDB-style files is described here.)

Timeline for d1f3ja1: