Lineage for d3skkb_ (3skk B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850944Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1850945Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1850946Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 1851190Protein automated matches [190112] (3 species)
    not a true protein
  7. 1851191Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)
  8. 1851201Domain d3skkb_: 3skk B: [216439]
    automated match to d2zava_
    complexed with 4u7, mn

Details for d3skkb_

PDB Entry: 3skk (more details), 1.7 Å

PDB Description: Crystal structure of human arginase I in complex with the inhibitor FABH, Resolution 1.70 A, twinned structure
PDB Compounds: (B:) Arginase-1

SCOPe Domain Sequences for d3skkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3skkb_ c.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspfq
ivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvda
htdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdpg
ehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpatg
tpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacfg
laregnhkpidyln

SCOPe Domain Coordinates for d3skkb_:

Click to download the PDB-style file with coordinates for d3skkb_.
(The format of our PDB-style files is described here.)

Timeline for d3skkb_: