Lineage for d3skje_ (3skj E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775243Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2775311Domain d3skje_: 3skj E: [216433]
    Other proteins in same PDB: d3skjh_, d3skji_, d3skjl1, d3skjl2, d3skjm1, d3skjm2
    automated match to d1nuka_

Details for d3skje_

PDB Entry: 3skj (more details), 2.5 Å

PDB Description: structural and functional characterization of an agonistic anti-human epha2 monoclonal antibody
PDB Compounds: (E:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3skje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3skje_ b.18.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgkevvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtn
wvyrgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidt
iapdeitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykk

SCOPe Domain Coordinates for d3skje_:

Click to download the PDB-style file with coordinates for d3skje_.
(The format of our PDB-style files is described here.)

Timeline for d3skje_: