![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
![]() | Domain d3skje_: 3skj E: [216433] Other proteins in same PDB: d3skjh_, d3skji_, d3skjl1, d3skjl2, d3skjm1, d3skjm2 automated match to d1nuka_ |
PDB Entry: 3skj (more details), 2.5 Å
SCOPe Domain Sequences for d3skje_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3skje_ b.18.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qgkevvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtn wvyrgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidt iapdeitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykk
Timeline for d3skje_: