SCOPe 2.06: Domain d1es0a1: 1es0 A:83-178

Lineage for d1es0a1 (1es0 A:83-178)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1es0a1: 1es0 A:83-178 [21643]
   Other proteins in same PDB: d1es0a2, d1es0a3, d1es0b1, d1es0b2, d1es0b3
   contains covalently bound peptides

Details for d1es0a1

PDB Entry: 1es0, 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220

PDB Compounds: (A:) h-2 class II histocompatibility antigen

SCOPe Domain Sequences for d1es0a1:

Sequence; same for both SEQRES and ATOM records:

>d1es0a1 b.1.1.2 (A:83-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhw

Timeline for d1es0a1:

• d1es0a1 first appeared (with stable ids) in SCOP 1.55
  
• d1es0a1 appears in SCOPe 2.05
  
• d1es0a1 appears in SCOPe 2.07
  
• d1es0a1 appears in the current release, SCOPe 2.08