Lineage for d1es0a1 (1es0 A:83-180)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760280Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1760346Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (25 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1760354Domain d1es0a1: 1es0 A:83-180 [21643]
    Other proteins in same PDB: d1es0a2, d1es0b1, d1es0b2
    contains covalently bound peptides

Details for d1es0a1

PDB Entry: 1es0 (more details), 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220
PDB Compounds: (A:) h-2 class II histocompatibility antigen

SCOPe Domain Sequences for d1es0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es0a1 b.1.1.2 (A:83-180) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwss

SCOPe Domain Coordinates for d1es0a1:

Click to download the PDB-style file with coordinates for d1es0a1.
(The format of our PDB-style files is described here.)

Timeline for d1es0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1es0a2