Lineage for d3sj6a_ (3sj6 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939732Protein automated matches [190420] (8 species)
    not a true protein
  7. 1939756Species Momordica balsamina [TaxId:3672] [189375] (66 PDB entries)
  8. 1939758Domain d3sj6a_: 3sj6 A: [216422]
    automated match to d3mrwa_
    protein/RNA complex; complexed with gol, nag, rip

Details for d3sj6a_

PDB Entry: 3sj6 (more details), 1.6 Å

PDB Description: crystal structure of the complex of type i ribosome inactivating protein from momordica balsamina with 5-(hydroxymethyl)oxalane-2,3,4- triol at 1.6 a resolution
PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3sj6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sj6a_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

SCOPe Domain Coordinates for d3sj6a_:

Click to download the PDB-style file with coordinates for d3sj6a_.
(The format of our PDB-style files is described here.)

Timeline for d3sj6a_: