SCOPe 2.05: Domain d3sj6a_: 3sj6 A:

Lineage for d3sj6a_ (3sj6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein automated matches [190420] (8 species)
   not a true protein

7. Species Momordica balsamina [TaxId:3672] [189375] (66 PDB entries)

8. Domain d3sj6a_: 3sj6 A: [216422]
   automated match to d3mrwa_
   protein/RNA complex; complexed with gol, nag, rip

Details for d3sj6a_

PDB Entry: 3sj6, 1.6 Å

PDB Description: crystal structure of the complex of type i ribosome inactivating protein from momordica balsamina with 5-(hydroxymethyl)oxalane-2,3,4- triol at 1.6 a resolution

PDB Compounds: (A:) Ribosome inactivating protein

SCOPe Domain Sequences for d3sj6a_:

Sequence; same for both SEQRES and ATOM records:

>d3sj6a_ d.165.1.1 (A:) automated matches {Momordica balsamina [TaxId: 3672]}
dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
lntkni

Timeline for d3sj6a_:

• d3sj6a_ first appeared in SCOPe 2.03
  
• d3sj6a_ appears in SCOPe 2.04
  
• d3sj6a_ appears in SCOPe 2.06
  
• d3sj6a_ appears in the current release, SCOPe 2.08