SCOPe 2.08: Domain d3sgvb_: 3sgv B:

Lineage for d3sgvb_ (3sgv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein Undecaprenyl diphosphate synthase [64007] (3 species)

7. Species Escherichia coli [TaxId:562] [64009] (17 PDB entries)

8. Domain d3sgvb_: 3sgv B: [216411]
   automated match to d1ueha_
   complexed with 2bj

Details for d3sgvb_

PDB Entry: 3sgv, 1.61 Å

PDB Description: Crystal Structure of E. coli undecaprenyl pyrophosphate synthase in complex with BPH-1290

PDB Compounds: (B:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d3sgvb_:

Sequence, based on SEQRES records:

>d3sgvb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafss
enwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealta
gntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlv
irtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre

Sequence, based on observed residues (ATOM records):

>d3sgvb_ c.101.1.1 (B:) Undecaprenyl diphosphate synthase {Escherichia coli [TaxId: 562]}
lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafvs
almelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaa
nyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisn
fllwqiayaelyftdvlwpdfdeqdfegalnafanre

Timeline for d3sgvb_:

• d3sgvb_ first appeared in SCOPe 2.03
  
• d3sgvb_ appears in SCOPe 2.07