Lineage for d1iaoa1 (1iao A:83-178)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220822Species Mouse (Mus musculus), I-AD [TaxId:10090] [49140] (2 PDB entries)
  8. 220825Domain d1iaoa1: 1iao A:83-178 [21641]
    Other proteins in same PDB: d1iaoa2, d1iaob2

Details for d1iaoa1

PDB Entry: 1iao (more details), 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339
PDB Compounds: (A:)

SCOP Domain Sequences for d1iaoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaoa1 b.1.1.2 (A:83-178) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AD}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhw

SCOP Domain Coordinates for d1iaoa1:

Click to download the PDB-style file with coordinates for d1iaoa1.
(The format of our PDB-style files is described here.)

Timeline for d1iaoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaoa2