SCOPe 2.08: Domain d3sgkc2: 3sgk C:87-174

Lineage for d3sgkc2 (3sgk C:87-174)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
   Uniprot O75015 23-189

8. Domain d3sgkc2: 3sgk C:87-174 [216406]
   Other proteins in same PDB: d3sgka1, d3sgka2, d3sgkb1, d3sgkb2
   automated match to d1fnla2
   complexed with mli

Details for d3sgkc2

PDB Entry: 3sgk, 2.4 Å

PDB Description: unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose

PDB Compounds: (C:) human Fcg3a receptor

SCOPe Domain Sequences for d3sgkc2:

Sequence; same for both SEQRES and ATOM records:

>d3sgkc2 b.1.1.4 (C:87-174) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
higwlllqaprwvfkeedpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl
kdsgsyfcrglvgsknvssetvqititq

Timeline for d3sgkc2:

• d3sgkc2 first appeared in SCOPe 2.03
  
• d3sgkc2 appears in SCOPe 2.07