Lineage for d3sgkc1 (3sgk C:5-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753603Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 2753612Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries)
    Uniprot O75015 23-189
  8. 2753619Domain d3sgkc1: 3sgk C:5-86 [216405]
    Other proteins in same PDB: d3sgka1, d3sgka2, d3sgkb1, d3sgkb2
    automated match to d1fnla1
    complexed with mli

Details for d3sgkc1

PDB Entry: 3sgk (more details), 2.4 Å

PDB Description: unique carbohydrate/carbohydrate interactions are required for high affinity binding of fcgiii and antibodies lacking core fucose
PDB Compounds: (C:) human Fcg3a receptor

SCOPe Domain Sequences for d3sgkc1:

Sequence, based on SEQRES records: (download)

>d3sgkc1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
lpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvd
dsgeyrcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records): (download)

>d3sgkc1 b.1.1.4 (C:5-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
lpkavvflepqwyrvlekdsvtlkcqgaqstqwfhneslissqassyfidaatvddsgey
rcqtqlstlsdpvqlev

SCOPe Domain Coordinates for d3sgkc1:

Click to download the PDB-style file with coordinates for d3sgkc1.
(The format of our PDB-style files is described here.)

Timeline for d3sgkc1: