Lineage for d2iadb1 (2iad B:94-190)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760407Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1760478Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (17 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 1760493Domain d2iadb1: 2iad B:94-190 [21640]
    Other proteins in same PDB: d2iada1, d2iada2, d2iadb2
    contains covalently bound peptides

Details for d2iadb1

PDB Entry: 2iad (more details), 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138
PDB Compounds: (B:) MHC class II I-ad

SCOPe Domain Sequences for d2iadb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iadb1 b.1.1.2 (B:94-190) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvewss

SCOPe Domain Coordinates for d2iadb1:

Click to download the PDB-style file with coordinates for d2iadb1.
(The format of our PDB-style files is described here.)

Timeline for d2iadb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iadb2