![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein automated matches [190803] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries) |
![]() | Domain d3sgjc1: 3sgj C:6-86 [216399] Other proteins in same PDB: d3sgja1, d3sgja2, d3sgjb1, d3sgjb2 automated match to d1fnla1 complexed with mli |
PDB Entry: 3sgj (more details), 2.2 Å
SCOPe Domain Sequences for d3sgjc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sgjc1 b.1.1.4 (C:6-86) automated matches {Human (Homo sapiens) [TaxId: 9606]} pkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvdd sgeyrcqtqlstlsdpvqlev
Timeline for d3sgjc1:
![]() Domains from other chains: (mouse over for more information) d3sgja1, d3sgja2, d3sgjb1, d3sgjb2 |