Lineage for d2iada1 (2iad A:83-178)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026687Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 2026753Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (27 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 2026777Domain d2iada1: 2iad A:83-178 [21639]
    Other proteins in same PDB: d2iada2, d2iada3, d2iadb1, d2iadb2
    contains covalently bound peptides

Details for d2iada1

PDB Entry: 2iad (more details), 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138
PDB Compounds: (A:) MHC class II I-ad

SCOPe Domain Sequences for d2iada1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iada1 b.1.1.2 (A:83-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhw

SCOPe Domain Coordinates for d2iada1:

Click to download the PDB-style file with coordinates for d2iada1.
(The format of our PDB-style files is described here.)

Timeline for d2iada1: