Lineage for d2iada1 (2iad A:83-186)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 288908Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 288947Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (10 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 288956Domain d2iada1: 2iad A:83-186 [21639]
    Other proteins in same PDB: d2iada2, d2iadb1, d2iadb2
    contains covalently bound peptides

Details for d2iada1

PDB Entry: 2iad (more details), 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138
PDB Compounds: (A:)

SCOP Domain Sequences for d2iada1:

Sequence, based on SEQRES records: (download)

>d2iada1 b.1.1.2 (A:83-186) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepeissadlvpr

Sequence, based on observed residues (ATOM records): (download)

>d2iada1 b.1.1.2 (A:83-186) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwssadlvpr

SCOP Domain Coordinates for d2iada1:

Click to download the PDB-style file with coordinates for d2iada1.
(The format of our PDB-style files is described here.)

Timeline for d2iada1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iada2