Lineage for d2iada1 (2iad A:83-186)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220734Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)
  7. 220822Species Mouse (Mus musculus), I-AD [TaxId:10090] [49140] (2 PDB entries)
  8. 220823Domain d2iada1: 2iad A:83-186 [21639]
    Other proteins in same PDB: d2iada2, d2iadb2

Details for d2iada1

PDB Entry: 2iad (more details), 2.4 Å

PDB Description: class ii mhc i-ad in complex with an influenza hemagglutinin peptide 126-138
PDB Compounds: (A:)

SCOP Domain Sequences for d2iada1:

Sequence, based on SEQRES records: (download)

>d2iada1 b.1.1.2 (A:83-186) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AD}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwepeissadlvpr

Sequence, based on observed residues (ATOM records): (download)

>d2iada1 b.1.1.2 (A:83-186) Class II MHC, C-terminal domains of alpha and beta chains {Mouse (Mus musculus), I-AD}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhwssadlvpr

SCOP Domain Coordinates for d2iada1:

Click to download the PDB-style file with coordinates for d2iada1.
(The format of our PDB-style files is described here.)

Timeline for d2iada1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iada2