SCOP 1.65: Domain d1iebd1: 1ieb D:93-188

Lineage for d1iebd1 (1ieb D:93-188)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (7 PDB entries)
probably orthologous to the human HLA-DR group

Domain d1iebd1: 1ieb D:93-188 [21638]
Other proteins in same PDB: d1ieba1, d1ieba2, d1iebb2, d1iebc1, d1iebc2, d1iebd2
contains covalently bound peptides at the N-termini of chains B and D
complexed with nag, so4

Details for d1iebd1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1iebd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iebd1 b.1.1.2 (D:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOP Domain Coordinates for d1iebd1:

Click to download the PDB-style file with coordinates for d1iebd1.
(The format of our PDB-style files is described here.)

Timeline for d1iebd1: