Class a: All alpha proteins [46456] (284 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (15 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries) |
Domain d3sf6a2: 3sf6 A:247-399 [216378] Other proteins in same PDB: d3sf6a1 automated match to d1siqa1 complexed with cl, edo, fda, so4, unl |
PDB Entry: 3sf6 (more details), 1.7 Å
SCOPe Domain Sequences for d3sf6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sf6a2 a.29.3.0 (A:247-399) automated matches {Mycobacterium smegmatis [TaxId: 246196]} lgaplrclnearfgivfgalgaardcletalayacsreqfdrpiggfqltqqkladmtle ygkgfllalhlgrqkdagelapeqvslgklnnvreaieiartartvlgasgitgeypvmr hannlesvltyegtsemhtliigqaltgvgafr
Timeline for d3sf6a2: