SCOPe 2.08: Domain d3sf6a2: 3sf6 A:247-399

Lineage for d3sf6a2 (3sf6 A:247-399)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries)

8. Domain d3sf6a2: 3sf6 A:247-399 [216378]
   Other proteins in same PDB: d3sf6a1
   automated match to d1siqa1
   complexed with cl, edo, fda, so4, unl

Details for d3sf6a2

PDB Entry: 3sf6, 1.7 Å

PDB Description: crystal structure of glutaryl-coa dehydrogenase from mycobacterium smegmatis

PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3sf6a2:

Sequence; same for both SEQRES and ATOM records:

>d3sf6a2 a.29.3.0 (A:247-399) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
lgaplrclnearfgivfgalgaardcletalayacsreqfdrpiggfqltqqkladmtle
ygkgfllalhlgrqkdagelapeqvslgklnnvreaieiartartvlgasgitgeypvmr
hannlesvltyegtsemhtliigqaltgvgafr

Timeline for d3sf6a2:

• d3sf6a2 first appeared in SCOPe 2.03
  
• d3sf6a2 appears in SCOPe 2.07