Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (20 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries) |
Domain d3sf6a1: 3sf6 A:13-246 [216377] Other proteins in same PDB: d3sf6a2 automated match to d1siqa2 complexed with cl, edo, fda, so4, unl |
PDB Entry: 3sf6 (more details), 1.7 Å
SCOPe Domain Sequences for d3sf6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sf6a1 e.6.1.0 (A:13-246) automated matches {Mycobacterium smegmatis [TaxId: 246196]} rrgaddliginavlsaeereirdtvrsvvqrrikphiaswyedgelparelavelgelgl lgmhlkgygcagmsavayglacleleagdsgirslvsvqgslamyaihafgsdeqkdqwl pdmasghrigcfgltepdhgsdpagmrtratrsgddwiltgtkmwitngsvadvavvwar tdegirgfvvptdtpgftantikskmslrasvtselvldgvrlpdsarlpgats
Timeline for d3sf6a1: