Lineage for d3sf6a1 (3sf6 A:13-246)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1951081Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1951082Protein automated matches [226934] (20 species)
    not a true protein
  7. 1951170Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries)
  8. 1951175Domain d3sf6a1: 3sf6 A:13-246 [216377]
    Other proteins in same PDB: d3sf6a2
    automated match to d1siqa2
    complexed with cl, edo, fda, so4, unl

Details for d3sf6a1

PDB Entry: 3sf6 (more details), 1.7 Å

PDB Description: crystal structure of glutaryl-coa dehydrogenase from mycobacterium smegmatis
PDB Compounds: (A:) Glutaryl-CoA dehydrogenase

SCOPe Domain Sequences for d3sf6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sf6a1 e.6.1.0 (A:13-246) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
rrgaddliginavlsaeereirdtvrsvvqrrikphiaswyedgelparelavelgelgl
lgmhlkgygcagmsavayglacleleagdsgirslvsvqgslamyaihafgsdeqkdqwl
pdmasghrigcfgltepdhgsdpagmrtratrsgddwiltgtkmwitngsvadvavvwar
tdegirgfvvptdtpgftantikskmslrasvtselvldgvrlpdsarlpgats

SCOPe Domain Coordinates for d3sf6a1:

Click to download the PDB-style file with coordinates for d3sf6a1.
(The format of our PDB-style files is described here.)

Timeline for d3sf6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sf6a2