Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries) probably orthologous to the human HLA-DR group |
Domain d1iebc1: 1ieb C:82-182 [21637] Other proteins in same PDB: d1ieba2, d1iebb1, d1iebb2, d1iebc2, d1iebd1, d1iebd2 complexed with nag, so4 |
PDB Entry: 1ieb (more details), 2.7 Å
SCOPe Domain Sequences for d1iebc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iebc1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee
Timeline for d1iebc1: