SCOPe 2.05: Domain d3seta_: 3set A:

Lineage for d3seta_ (3set A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (64 PDB entries)
   Uniprot P02928

8. Domain d3seta_: 3set A: [216368]
   automated match to d1a7lc_
   complexed with mal, ni

Details for d3seta_

PDB Entry: 3set, 1.9 Å

PDB Description: ni-mediated dimer of maltose-binding protein a216h/k220h by synthetic symmetrization (form i)

PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3seta_:

Sequence; same for both SEQRES and ATOM records:

>d3seta_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqtnaaa

Timeline for d3seta_:

• d3seta_ first appeared in SCOPe 2.03
  
• d3seta_ appears in SCOPe 2.04
  
• d3seta_ is called d3seta1 in SCOPe 2.06
  
• d3seta_ appears in the current release, SCOPe 2.08, called d3seta1