Lineage for d3sesa_ (3ses A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879093Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 1879108Species Escherichia coli [TaxId:562] [53863] (64 PDB entries)
    Uniprot P02928
  8. 1879119Domain d3sesa_: 3ses A: [216366]
    automated match to d1a7lc_
    complexed with cl, cu, mal

Details for d3sesa_

PDB Entry: 3ses (more details), 1.9 Å

PDB Description: Cu-mediated Dimer of Maltose-binding Protein A216H/K220H by Synthetic Symmetrization
PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3sesa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sesa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqtnaaa

SCOPe Domain Coordinates for d3sesa_:

Click to download the PDB-style file with coordinates for d3sesa_.
(The format of our PDB-style files is described here.)

Timeline for d3sesa_: