![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (41 protein domains) |
![]() | Protein D-maltodextrin-binding protein, MBP [53862] (5 species) contains a few additional helices in the C-terminal extension; homologous to thiaminase I |
![]() | Species Escherichia coli [TaxId:562] [53863] (55 PDB entries) Uniprot P02928 |
![]() | Domain d3sesa_: 3ses A: [216366] automated match to d1a7lc_ complexed with cl, cu, mal |
PDB Entry: 3ses (more details), 1.9 Å
SCOPe Domain Sequences for d3sesa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sesa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd vgvdnagakagltflvdliknkhmnadtdysiaehafnhgetamtingpwawsnidtskv nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa laaaqtnaaa
Timeline for d3sesa_: