SCOPe 2.03: Domain d3serc_: 3ser C:

Lineage for d3serc_ (3ser C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (55 PDB entries)
   Uniprot P02928

8. Domain d3serc_: 3ser C: [216365]
   automated match to d1a7lc_
   complexed with ca, cl, mal, zn

Details for d3serc_

PDB Entry: 3ser, 2.35 Å

PDB Description: zn-mediated polymer of maltose-binding protein k26h/k30h by synthetic symmetrization

PDB Compounds: (C:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3serc_:

Sequence; same for both SEQRES and ATOM records:

>d3serc_ c.94.1.1 (C:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevghkfehdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqtnaaa

Timeline for d3serc_:

• d3serc_ is new in SCOPe 2.03-stable
  
• d3serc_ appears in SCOPe 2.04
  
• d3serc_ appears in the current release, SCOPe 2.08, called d3serc1