SCOPe 2.08: Domain d3sdya1: 3sdy A:11-327

Lineage for d3sdya1 (3sdy A:11-327)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (22 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)

8. Domain d3sdya1: 3sdy A:11-327 [216356]
   Other proteins in same PDB: d3sdya2, d3sdyb_, d3sdyh_, d3sdyl1, d3sdyl2
   automated match to d2viua_
   complexed with so4

Details for d3sdya1

PDB Entry: 3sdy, 2.85 Å

PDB Description: crystal structure of broadly neutralizing antibody cr8020 bound to the influenza a h3 hemagglutinin

PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3sdya1:

Sequence; same for both SEQRES and ATOM records:

>d3sdya1 b.19.1.2 (A:11-327) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpekq

Timeline for d3sdya1:

• d3sdya1 first appeared in SCOPe 2.03, called d3sdya_
  
• d3sdya1 appears in SCOPe 2.07