SCOPe 2.07: Domain d3sdsc2: 3sds C:182-349

Lineage for d3sdsc2 (3sds C:182-349)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Coccidioides immitis [TaxId:246410] [226160] (1 PDB entry)

8. Domain d3sdsc2: 3sds C:182-349 [216355]
   automated match to d1otha2
   complexed with cl

Details for d3sdsc2

PDB Entry: 3sds, 2.8 Å

PDB Description: Crystal structure of a mitochondrial ornithine carbamoyltransferase from Coccidioides immitis

PDB Compounds: (C:) Ornithine carbamoyltransferase, mitochondrial

SCOPe Domain Sequences for d3sdsc2:

Sequence, based on SEQRES records:

>d3sdsc2 c.78.1.0 (C:182-349) automated matches {Coccidioides immitis [TaxId: 246410]}
leglkiawvgdannvlfdlaiaatkmgvnvavatprgyeipshiveliqkaregvqspgn
ltqttvpevavkdadvivtdtwismgqetekikrleafkdfkvtselakrggakenwkfm
hclprhpeevsdevfyserslvfpeaenrlwaaisaleafvvnkgkia

Sequence, based on observed residues (ATOM records):

>d3sdsc2 c.78.1.0 (C:182-349) automated matches {Coccidioides immitis [TaxId: 246410]}
leglkiawvgdannvlfdlaiaatkmgvnvavatprgyeipshiveliqkaregvqspgn
ltqttvpevavkdadvivtdtwkikrleafkdfkvtselakrggakenwkfmhclprhpe
evsdevfyserslvfpeaenrlwaaisaleafvvnkgkia

Timeline for d3sdsc2:

• d3sdsc2 first appeared in SCOPe 2.03
  
• d3sdsc2 appears in SCOPe 2.06