Lineage for d3sdsb2 (3sds B:182-349)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139045Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2139046Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2139496Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2139497Protein automated matches [226938] (22 species)
    not a true protein
  7. 2139556Species Coccidioides immitis [TaxId:246410] [226160] (1 PDB entry)
  8. 2139560Domain d3sdsb2: 3sds B:182-349 [216353]
    automated match to d1otha2
    complexed with cl

Details for d3sdsb2

PDB Entry: 3sds (more details), 2.8 Å

PDB Description: Crystal structure of a mitochondrial ornithine carbamoyltransferase from Coccidioides immitis
PDB Compounds: (B:) Ornithine carbamoyltransferase, mitochondrial

SCOPe Domain Sequences for d3sdsb2:

Sequence, based on SEQRES records: (download)

>d3sdsb2 c.78.1.0 (B:182-349) automated matches {Coccidioides immitis [TaxId: 246410]}
leglkiawvgdannvlfdlaiaatkmgvnvavatprgyeipshiveliqkaregvqspgn
ltqttvpevavkdadvivtdtwismgqetekikrleafkdfkvtselakrggakenwkfm
hclprhpeevsdevfyserslvfpeaenrlwaaisaleafvvnkgkia

Sequence, based on observed residues (ATOM records): (download)

>d3sdsb2 c.78.1.0 (B:182-349) automated matches {Coccidioides immitis [TaxId: 246410]}
leglkiawvgdannvlfdlaiaatkmgvnvavatprgyeipshiveliqkaregvqspgn
ltqttvpevavkdadvivtdtwkikrleafkdfkvtselakrggakenwkfmhclprhpe
evsdevfyserslvfpeaenrlwaaisaleafvvnkgkia

SCOPe Domain Coordinates for d3sdsb2:

Click to download the PDB-style file with coordinates for d3sdsb2.
(The format of our PDB-style files is described here.)

Timeline for d3sdsb2: