Lineage for d3sdsb1 (3sds B:17-167)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386472Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1386473Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1386919Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 1386920Protein automated matches [226938] (20 species)
    not a true protein
  7. 1386970Species Coccidioides immitis [TaxId:246410] [226160] (1 PDB entry)
  8. 1386973Domain d3sdsb1: 3sds B:17-167 [216352]
    automated match to d1otha1
    complexed with cl

Details for d3sdsb1

PDB Entry: 3sds (more details), 2.8 Å

PDB Description: Crystal structure of a mitochondrial ornithine carbamoyltransferase from Coccidioides immitis
PDB Compounds: (B:) Ornithine carbamoyltransferase, mitochondrial

SCOPe Domain Sequences for d3sdsb1:

Sequence, based on SEQRES records: (download)

>d3sdsb1 c.78.1.0 (B:17-167) automated matches {Coccidioides immitis [TaxId: 246410]}
stprhllsiadltptefatlvrnassykktiksdsmperltgalsgktvammfskrstrt
rvstegavvkmgghpmflgkddiqlgvneslydtsvvissmvscivarvgphsdianlak
hssvpvinalcdtfhplqaiadfltihesfa

Sequence, based on observed residues (ATOM records): (download)

>d3sdsb1 c.78.1.0 (B:17-167) automated matches {Coccidioides immitis [TaxId: 246410]}
stprhllsiadltptefatlvrnassykktiksdsmperltgalsgktvammfskrstrt
rvstegavvkmgghpmflgkddiqlgvneslydtsvvissmvscivarvhsdianlakhs
svpvinalcdtfhplqaiadfltihesfa

SCOPe Domain Coordinates for d3sdsb1:

Click to download the PDB-style file with coordinates for d3sdsb1.
(The format of our PDB-style files is described here.)

Timeline for d3sdsb1: