Lineage for d3sdsa1 (3sds A:18-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906944Species Coccidioides immitis [TaxId:246410] [226160] (1 PDB entry)
  8. 2906945Domain d3sdsa1: 3sds A:18-167 [216350]
    automated match to d1otha1
    complexed with cl

Details for d3sdsa1

PDB Entry: 3sds (more details), 2.8 Å

PDB Description: Crystal structure of a mitochondrial ornithine carbamoyltransferase from Coccidioides immitis
PDB Compounds: (A:) Ornithine carbamoyltransferase, mitochondrial

SCOPe Domain Sequences for d3sdsa1:

Sequence, based on SEQRES records: (download)

>d3sdsa1 c.78.1.0 (A:18-167) automated matches {Coccidioides immitis [TaxId: 246410]}
tprhllsiadltptefatlvrnassykktiksdsmperltgalsgktvammfskrstrtr
vstegavvkmgghpmflgkddiqlgvneslydtsvvissmvscivarvgphsdianlakh
ssvpvinalcdtfhplqaiadfltihesfa

Sequence, based on observed residues (ATOM records): (download)

>d3sdsa1 c.78.1.0 (A:18-167) automated matches {Coccidioides immitis [TaxId: 246410]}
tprhllsiadltptefatlvrnassykktiksdsmperltgalsgktvammfskrstrtr
vstegavvkmgghpmflgkddigvneslydtsvvissmvscivarvgphsdianlakhss
vpvinalcdtfhplqaiadfltihesfa

SCOPe Domain Coordinates for d3sdsa1:

Click to download the PDB-style file with coordinates for d3sdsa1.
(The format of our PDB-style files is described here.)

Timeline for d3sdsa1: