Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (26 species) not a true protein |
Species Coccidioides immitis [TaxId:246410] [226160] (1 PDB entry) |
Domain d3sdsa1: 3sds A:18-167 [216350] automated match to d1otha1 complexed with cl |
PDB Entry: 3sds (more details), 2.8 Å
SCOPe Domain Sequences for d3sdsa1:
Sequence, based on SEQRES records: (download)
>d3sdsa1 c.78.1.0 (A:18-167) automated matches {Coccidioides immitis [TaxId: 246410]} tprhllsiadltptefatlvrnassykktiksdsmperltgalsgktvammfskrstrtr vstegavvkmgghpmflgkddiqlgvneslydtsvvissmvscivarvgphsdianlakh ssvpvinalcdtfhplqaiadfltihesfa
>d3sdsa1 c.78.1.0 (A:18-167) automated matches {Coccidioides immitis [TaxId: 246410]} tprhllsiadltptefatlvrnassykktiksdsmperltgalsgktvammfskrstrtr vstegavvkmgghpmflgkddigvneslydtsvvissmvscivarvgphsdianlakhss vpvinalcdtfhplqaiadfltihesfa
Timeline for d3sdsa1:
View in 3D Domains from other chains: (mouse over for more information) d3sdsb1, d3sdsb2, d3sdsc1, d3sdsc2 |