Lineage for d1ieba1 (1ieb A:82-182)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747348Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species)
  7. 2747463Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2747478Domain d1ieba1: 1ieb A:82-182 [21635]
    Other proteins in same PDB: d1ieba2, d1iebb1, d1iebb2, d1iebc2, d1iebd1, d1iebd2
    complexed with nag, so4

Details for d1ieba1

PDB Entry: 1ieb (more details), 2.7 Å

PDB Description: histocompatibility antigen
PDB Compounds: (A:) MHC class II I-ek

SCOPe Domain Sequences for d1ieba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieba1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOPe Domain Coordinates for d1ieba1:

Click to download the PDB-style file with coordinates for d1ieba1.
(The format of our PDB-style files is described here.)

Timeline for d1ieba1: