![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
![]() | Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries) probably orthologous to the human HLA-DR group |
![]() | Domain d1ieba1: 1ieb A:82-182 [21635] Other proteins in same PDB: d1ieba2, d1iebb1, d1iebb2, d1iebc2, d1iebd1, d1iebd2 complexed with nag, so4 |
PDB Entry: 1ieb (more details), 2.7 Å
SCOPe Domain Sequences for d1ieba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieba1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee
Timeline for d1ieba1: