SCOPe 2.03: Domain d3sdlb_: 3sdl B:

Lineage for d3sdlb_ (3sdl B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (3 species)
   not a true protein

7. Species Influenza b virus [TaxId:107412] [193690] (3 PDB entries)

8. Domain d3sdlb_: 3sdl B: [216349]
   automated match to d3rt3c_

Details for d3sdlb_

PDB Entry: 3sdl, 2.29 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d3sdlb_:

Sequence; same for both SEQRES and ATOM records:

>d3sdlb_ a.16.1.1 (B:) automated matches {Influenza b virus [TaxId: 107412]}
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfepy

Timeline for d3sdlb_:

• d3sdlb_ is new in SCOPe 2.03-stable
  
• d3sdlb_ appears in SCOPe 2.04
  
• d3sdlb_ appears in the current release, SCOPe 2.08