Lineage for d3sdla_ (3sdl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311100Protein automated matches [190929] (8 species)
    not a true protein
  7. 2311136Species Influenza B virus [TaxId:107412] [193690] (3 PDB entries)
  8. 2311138Domain d3sdla_: 3sdl A: [216348]
    Other proteins in same PDB: d3sdlc1, d3sdlc2, d3sdld1, d3sdld2
    automated match to d3rt3c_

Details for d3sdla_

PDB Entry: 3sdl (more details), 2.29 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza b virus, northeast structural genomics consortium target ids hx6481, hr2873, and or2
PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d3sdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdla_ a.16.1.1 (A:) automated matches {Influenza B virus [TaxId: 107412]}
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfe

SCOPe Domain Coordinates for d3sdla_:

Click to download the PDB-style file with coordinates for d3sdla_.
(The format of our PDB-style files is described here.)

Timeline for d3sdla_: