Lineage for d1iead1 (1iea D:93-188)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747484Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2747586Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (11 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 2747594Domain d1iead1: 1iea D:93-188 [21634]
    Other proteins in same PDB: d1ieaa1, d1ieaa2, d1ieab2, d1ieac1, d1ieac2, d1iead2
    contains covalently bound peptides at the N-termini of chains B and D
    complexed with nag

Details for d1iead1

PDB Entry: 1iea (more details), 2.3 Å

PDB Description: histocompatibility antigen
PDB Compounds: (D:) MHC class II I-ek

SCOPe Domain Sequences for d1iead1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iead1 b.1.1.2 (D:93-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngd
wtfqtlvmletvpqsgevytcqvehpsltdpvtvew

SCOPe Domain Coordinates for d1iead1:

Click to download the PDB-style file with coordinates for d1iead1.
(The format of our PDB-style files is described here.)

Timeline for d1iead1: