SCOPe 2.07: Domain d3scsb_: 3scs B:

Lineage for d3scsb_ (3scs B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Oryza sativa [TaxId:39947] [225407] (30 PDB entries)

8. Domain d3scsb_: 3scs B: [216336]
   automated match to d1v03a_
   complexed with glf, gol, mes, so4, zn; mutant

Details for d3scsb_

PDB Entry: 3scs, 1.85 Å

PDB Description: crystal structure of rice bglu1 e386s mutant complexed with alpha- glucosyl fluoride

PDB Compounds: (B:) Beta-glucosidase 7

SCOPe Domain Sequences for d3scsb_:

Sequence; same for both SEQRES and ATOM records:

>d3scsb_ c.1.8.0 (B:) automated matches {Oryza sativa [TaxId: 39947]}
nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallg
ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
gmygcvnyikqkygnptvvitsngmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh

Timeline for d3scsb_:

• d3scsb_ first appeared in SCOPe 2.03
  
• d3scsb_ appears in SCOPe 2.06
  
• d3scsb_ appears in the current release, SCOPe 2.08