Lineage for d1ieac1 (1iea C:82-182)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760280Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 1760386Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
    probably orthologous to the human HLA-DR group
  8. 1760392Domain d1ieac1: 1iea C:82-182 [21633]
    Other proteins in same PDB: d1ieaa2, d1ieab1, d1ieab2, d1ieac2, d1iead1, d1iead2
    complexed with nag

Details for d1ieac1

PDB Entry: 1iea (more details), 2.3 Å

PDB Description: histocompatibility antigen
PDB Compounds: (C:) MHC class II I-ek

SCOPe Domain Sequences for d1ieac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieac1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOPe Domain Coordinates for d1ieac1:

Click to download the PDB-style file with coordinates for d1ieac1.
(The format of our PDB-style files is described here.)

Timeline for d1ieac1: