SCOP 1.71: Domain d1ieac1: 1iea C:82-182

Lineage for d1ieac1 (1iea C:82-182)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries)
probably orthologous to the human HLA-DR group
Domain d1ieac1: 1iea C:82-182 [21633]
Other proteins in same PDB: d1ieaa2, d1ieab1, d1ieab2, d1ieac2, d1iead1, d1iead2
complexed with nag

Details for d1ieac1

PDB Entry: 1iea (more details), 2.3 Å

PDB Description: histocompatibility antigen

SCOP Domain Sequences for d1ieac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieac1 b.1.1.2 (C:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee

SCOP Domain Coordinates for d1ieac1:

Click to download the PDB-style file with coordinates for d1ieac1.
(The format of our PDB-style files is described here.)

Timeline for d1ieac1: