| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
| Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
| Species Streptomyces wedmorensis [TaxId:43759] [140517] (13 PDB entries) Uniprot Q56185 6-76 |
| Domain d3scha1: 3sch A:5-76 [216321] Other proteins in same PDB: d3scha2, d3schb2 automated match to d1zz6a1 complexed with co, tb6 |
PDB Entry: 3sch (more details), 2.1 Å
SCOPe Domain Sequences for d3scha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3scha1 a.35.1.3 (A:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
tsigaltppagn
Timeline for d3scha1: