Lineage for d3scha1 (3sch A:5-76)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1268060Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1268061Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1268157Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 1268166Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 1268167Species Streptomyces wedmorensis [TaxId:43759] [140517] (13 PDB entries)
    Uniprot Q56185 6-76
  8. 1268174Domain d3scha1: 3sch A:5-76 [216321]
    Other proteins in same PDB: d3scha2, d3schb2
    automated match to d1zz6a1
    complexed with co, tb6

Details for d3scha1

PDB Entry: 3sch (more details), 2.1 Å

PDB Description: co(ii)-hppe with r-hpp
PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d3scha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scha1 a.35.1.3 (A:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
tsigaltppagn

SCOPe Domain Coordinates for d3scha1:

Click to download the PDB-style file with coordinates for d3scha1.
(The format of our PDB-style files is described here.)

Timeline for d3scha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3scha2