Lineage for d3scfb2 (3scf B:77-198)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080608Family b.82.1.10: TM1459-like [101976] (3 proteins)
  6. 2080609Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. 2080610Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
    Uniprot Q56185 77-198
  8. 2080643Domain d3scfb2: 3scf B:77-198 [216318]
    Other proteins in same PDB: d3scfa1, d3scfb1, d3scfc1
    automated match to d1zz6a2
    complexed with fe2, gol, no, s0h

Details for d3scfb2

PDB Entry: 3scf (more details), 2.85 Å

PDB Description: Fe(II)-HppE with S-HPP and NO
PDB Compounds: (B:) epoxidase

SCOPe Domain Sequences for d3scfb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scfb2 b.82.1.10 (B:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

SCOPe Domain Coordinates for d3scfb2:

Click to download the PDB-style file with coordinates for d3scfb2.
(The format of our PDB-style files is described here.)

Timeline for d3scfb2: