SCOPe 2.06: Domain d3scfb1: 3scf B:6-76

Lineage for d3scfb1 (3scf B:6-76)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
   Uniprot Q56185 6-76

8. Domain d3scfb1: 3scf B:6-76 [216317]
   Other proteins in same PDB: d3scfa2, d3scfb2, d3scfc2
   automated match to d1zz6a1
   complexed with fe2, gol, no, s0h

Details for d3scfb1

PDB Entry: 3scf, 2.85 Å

PDB Description: Fe(II)-HppE with S-HPP and NO

PDB Compounds: (B:) epoxidase

SCOPe Domain Sequences for d3scfb1:

Sequence; same for both SEQRES and ATOM records:

>d3scfb1 a.35.1.3 (B:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

Timeline for d3scfb1:

• d3scfb1 first appeared in SCOPe 2.03
  
• d3scfb1 appears in SCOPe 2.05
  
• d3scfb1 appears in SCOPe 2.07
  
• d3scfb1 appears in the current release, SCOPe 2.08