| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
| Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
| Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries) Uniprot Q56185 6-76 |
| Domain d3scfb1: 3scf B:6-76 [216317] Other proteins in same PDB: d3scfa2, d3scfb2, d3scfc2 automated match to d1zz6a1 complexed with fe2, gol, no, s0h |
PDB Entry: 3scf (more details), 2.85 Å
SCOPe Domain Sequences for d3scfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3scfb1 a.35.1.3 (B:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn
Timeline for d3scfb1:
View in 3DDomains from other chains: (mouse over for more information) d3scfa1, d3scfa2, d3scfc1, d3scfc2 |