| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.10: TM1459-like [101976] (3 proteins) |
| Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species) |
| Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries) Uniprot Q56185 77-198 |
| Domain d3scfa2: 3scf A:77-198 [216316] Other proteins in same PDB: d3scfa1, d3scfb1, d3scfc1 automated match to d1zz6a2 complexed with fe2, gol, no, s0h |
PDB Entry: 3scf (more details), 2.85 Å
SCOPe Domain Sequences for d3scfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3scfa2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf
Timeline for d3scfa2:
View in 3DDomains from other chains: (mouse over for more information) d3scfb1, d3scfb2, d3scfc1, d3scfc2 |