![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
![]() | Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
![]() | Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
![]() | Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
![]() | Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries) Uniprot Q56185 6-76 |
![]() | Domain d3scfa1: 3scf A:6-76 [216315] Other proteins in same PDB: d3scfa2, d3scfb2, d3scfc2 automated match to d1zz6a1 complexed with fe2, gol, no, s0h |
PDB Entry: 3scf (more details), 2.85 Å
SCOPe Domain Sequences for d3scfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3scfa1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt sigaltppagn
Timeline for d3scfa1:
![]() Domains from other chains: (mouse over for more information) d3scfb1, d3scfb2, d3scfc1, d3scfc2 |