SCOPe 2.03: Domain d3scfa1: 3scf A:6-76

Lineage for d3scfa1 (3scf A:6-76)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (13 PDB entries)
   Uniprot Q56185 6-76

8. Domain d3scfa1: 3scf A:6-76 [216315]
   Other proteins in same PDB: d3scfa2, d3scfb2, d3scfc2
   automated match to d1zz6a1
   complexed with fe2, gol, no, s0h

Details for d3scfa1

PDB Entry: 3scf, 2.85 Å

PDB Description: Fe(II)-HppE with S-HPP and NO

PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d3scfa1:

Sequence; same for both SEQRES and ATOM records:

>d3scfa1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

Timeline for d3scfa1:

• d3scfa1 is new in SCOPe 2.03-stable
  
• d3scfa1 appears in SCOPe 2.04
  
• d3scfa1 appears in the current release, SCOPe 2.08