Lineage for d3scfa1 (3scf A:6-76)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709414Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. 2709427Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. 2709428Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. 2709458Domain d3scfa1: 3scf A:6-76 [216315]
    Other proteins in same PDB: d3scfa2, d3scfb2, d3scfc2
    automated match to d1zz6a1
    complexed with fe2, gol, no, s0h

Details for d3scfa1

PDB Entry: 3scf (more details), 2.85 Å

PDB Description: Fe(II)-HppE with S-HPP and NO
PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d3scfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3scfa1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlgt
sigaltppagn

SCOPe Domain Coordinates for d3scfa1:

Click to download the PDB-style file with coordinates for d3scfa1.
(The format of our PDB-style files is described here.)

Timeline for d3scfa1: