SCOPe 2.08: Domain d3sbrh2: 3sbr H:508-638

Lineage for d3sbrh2 (3sbr H:508-638)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries)

8. Domain d3sbrh2: 3sbr H:508-638 [216313]
   Other proteins in same PDB: d3sbra1, d3sbrb1, d3sbrc1, d3sbrd1, d3sbre1, d3sbrf1, d3sbrg1, d3sbrh1
   automated match to d1qnia1
   complexed with ca, cl, cua, cuk, imd, k, n2o

Details for d3sbrh2

PDB Entry: 3sbr, 2.24 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase, p1 crystal form with substrate

PDB Compounds: (H:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbrh2:

Sequence; same for both SEQRES and ATOM records:

>d3sbrh2 b.6.1.0 (H:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

Timeline for d3sbrh2:

• d3sbrh2 first appeared in SCOPe 2.03
  
• d3sbrh2 appears in SCOPe 2.07