| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class II MHC alpha chain, C-terminal domain [88618] (7 species) |
| Species Mouse (Mus musculus), I-E group [TaxId:10090] [88622] (9 PDB entries) probably orthologous to the human HLA-DR group |
| Domain d1ieaa1: 1iea A:82-182 [21631] Other proteins in same PDB: d1ieaa2, d1ieab1, d1ieab2, d1ieac2, d1iead1, d1iead2 complexed with nag |
PDB Entry: 1iea (more details), 2.3 Å
SCOPe Domain Sequences for d1ieaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieaa1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
danvapevtvlsrspvnlgepnilicfidkfsppvvnvtwlrngrpvtegvsetvflprd
dhlfrkfhyltflpstddfydcevdhwgleeplrktwefee
Timeline for d1ieaa1: