Lineage for d3sbqa2 (3sbq A:508-638)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2366402Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2366403Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2367979Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2367980Protein automated matches [190824] (23 species)
    not a true protein
  7. 2368280Species Pseudomonas stutzeri [TaxId:316] [226186] (3 PDB entries)
  8. 2368289Domain d3sbqa2: 3sbq A:508-638 [216295]
    Other proteins in same PDB: d3sbqa1, d3sbqb1
    automated match to d1qnia1
    complexed with ca, cl, cua, cuk, imd, k

Details for d3sbqa2

PDB Entry: 3sbq (more details), 1.7 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase, p65 crystal form
PDB Compounds: (A:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbqa2 b.6.1.0 (A:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

SCOPe Domain Coordinates for d3sbqa2:

Click to download the PDB-style file with coordinates for d3sbqa2.
(The format of our PDB-style files is described here.)

Timeline for d3sbqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sbqa1