Lineage for d3sbqa1 (3sbq A:58-507)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065931Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 2065932Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 protein domains)
  6. 2065946Protein automated matches [226900] (3 species)
    not a true protein
  7. 2065952Species Pseudomonas stutzeri [TaxId:316] [226185] (3 PDB entries)
  8. 2065953Domain d3sbqa1: 3sbq A:58-507 [216294]
    Other proteins in same PDB: d3sbqa2, d3sbqb2
    automated match to d1qnia2
    complexed with ca, cl, cua, cuk, imd, k

Details for d3sbqa1

PDB Entry: 3sbq (more details), 1.7 Å

PDB Description: pseudomonas stutzeri nitrous oxide reductase, p65 crystal form
PDB Compounds: (A:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbqa1 b.69.3.1 (A:58-507) automated matches {Pseudomonas stutzeri [TaxId: 316]}
qkihvgpgelddyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgltnesrhim
gdsakflngdchhphismtdgkydgkylfindkansrvarirldimkcdkmitvpnvqai
hglrlqkvphtkyvfanaefiiphpndgkvfdlqdensytmynaidaetmemafqvivdg
nldntdadytgrfaaatcynsekafdlggmmrnerdwvvvfdihaveaavkagdfitlgd
sktpvldgrkkdgkdskftryvpvpknphgcntssdgkyfiaagklsptcsmiaidklpd
lfagkladprdvivgepelglgplhttfdgrgnayttlfidsqvvkwnmeeavraykgek
vnyikqkldvhyqpghlhaslcetneadgkwlvalskfskdrflpvgplhpendqlidis
gdemklvhdgptfaephdcimarrdqiktk

SCOPe Domain Coordinates for d3sbqa1:

Click to download the PDB-style file with coordinates for d3sbqa1.
(The format of our PDB-style files is described here.)

Timeline for d3sbqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3sbqa2