SCOPe 2.05: Domain d3sbph2: 3sbp H:508-638

Lineage for d3sbph2 (3sbp H:508-638)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (21 species)
   not a true protein

7. Species Pseudomonas stutzeri [TaxId:316] [226186] (3 PDB entries)

8. Domain d3sbph2: 3sbp H:508-638 [216293]
   Other proteins in same PDB: d3sbpa1, d3sbpb1, d3sbpc1, d3sbpd1, d3sbpe1, d3sbpf1, d3sbpg1, d3sbph1
   automated match to d1qnia1
   complexed with ca, cl, cua, cuk, imd, k

Details for d3sbph2

PDB Entry: 3sbp, 2.1 Å

PDB Description: Pseudomonas stutzeri nitrous oxide reductase, P1 crystal form

PDB Compounds: (H:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbph2:

Sequence; same for both SEQRES and ATOM records:

>d3sbph2 b.6.1.0 (H:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

Timeline for d3sbph2:

• d3sbph2 first appeared in SCOPe 2.03
  
• d3sbph2 appears in SCOPe 2.04
  
• d3sbph2 appears in SCOPe 2.06
  
• d3sbph2 appears in the current release, SCOPe 2.08