Lineage for d3sbpg1 (3sbp G:54-507)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418312Superfamily b.69.3: Nitrous oxide reductase, N-terminal domain [50974] (1 family) (S)
  5. 2418313Family b.69.3.1: Nitrous oxide reductase, N-terminal domain [50975] (2 proteins)
  6. 2418327Protein automated matches [226900] (3 species)
    not a true protein
  7. 2418333Species Pseudomonas stutzeri [TaxId:316] [226185] (22 PDB entries)
  8. 2418376Domain d3sbpg1: 3sbp G:54-507 [216290]
    Other proteins in same PDB: d3sbpa2, d3sbpb2, d3sbpc2, d3sbpd2, d3sbpe2, d3sbpf2, d3sbpg2, d3sbph2
    automated match to d1qnia2
    complexed with ca, cl, cua, cuk, imd, k

Details for d3sbpg1

PDB Entry: 3sbp (more details), 2.1 Å

PDB Description: Pseudomonas stutzeri nitrous oxide reductase, P1 crystal form
PDB Compounds: (G:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbpg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbpg1 b.69.3.1 (G:54-507) automated matches {Pseudomonas stutzeri [TaxId: 316]}
keskqkihvgpgelddyygfwsgghqgevrvlgvpsmrelmripvfnvdsatgwgltnes
rhimgdsakflngdchhphismtdgkydgkylfindkansrvarirldimkcdkmitvpn
vqaihglrlqkvphtkyvfanaefiiphpndgkvfdlqdensytmynaidaetmemafqv
ivdgnldntdadytgrfaaatcynsekafdlggmmrnerdwvvvfdihaveaavkagdfi
tlgdsktpvldgrkkdgkdskftryvpvpknphgcntssdgkyfiaagklsptcsmiaid
klpdlfagkladprdvivgepelglgplhttfdgrgnayttlfidsqvvkwnmeeavray
kgekvnyikqkldvhyqpghlhaslcetneadgkwlvalskfskdrflpvgplhpendql
idisgdemklvhdgptfaephdcimarrdqiktk

SCOPe Domain Coordinates for d3sbpg1:

Click to download the PDB-style file with coordinates for d3sbpg1.
(The format of our PDB-style files is described here.)

Timeline for d3sbpg1: