Lineage for d3sbpc2 (3sbp C:508-638)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772605Species Pseudomonas stutzeri [TaxId:316] [226186] (22 PDB entries)
  8. 2772644Domain d3sbpc2: 3sbp C:508-638 [216283]
    Other proteins in same PDB: d3sbpa1, d3sbpb1, d3sbpc1, d3sbpd1, d3sbpe1, d3sbpf1, d3sbpg1, d3sbph1
    automated match to d1qnia1
    complexed with ca, cl, cua, cuk, imd, k

Details for d3sbpc2

PDB Entry: 3sbp (more details), 2.1 Å

PDB Description: Pseudomonas stutzeri nitrous oxide reductase, P1 crystal form
PDB Compounds: (C:) nitrous-oxide reductase

SCOPe Domain Sequences for d3sbpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sbpc2 b.6.1.0 (C:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]}
kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde
vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm
emvgrmmvepa

SCOPe Domain Coordinates for d3sbpc2:

Click to download the PDB-style file with coordinates for d3sbpc2.
(The format of our PDB-style files is described here.)

Timeline for d3sbpc2: